Lineage for d1nkwe_ (1nkw E:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3043573Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 3043708Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 3043709Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)
  8. 3043718Domain d1nkwe_: 1nkw E: [80590]
    CA-atoms only for the ribosomal protein structures

Details for d1nkwe_

PDB Entry: 1nkw (more details), 3.1 Å

PDB Description: Crystal Structure Of The Large Ribosomal Subunit From Deinococcus Radiodurans
PDB Compounds: (E:) 50S ribosomal protein L6

SCOPe Domain Sequences for d1nkwe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nkwe_ i.1.1.2 (E:) Prokaryotic (50S subunit) {Deinococcus radiodurans [TaxId: 1299]}
gkqpiavpsgvtvnaqdgvfkvkgpkgeltvpynteltvrqdgdqllverpsdaqkhral
hgltrtlvanavkgvsdgytinlelrgvgfrakltgkalemnigyshpviieppagvtfa
vpeptridvsgidkqlvgqvaanvrkvrkpdayhgkgvrfvgeqialkagkagatgg

SCOPe Domain Coordinates for d1nkwe_:

Click to download the PDB-style file with coordinates for d1nkwe_.
(The format of our PDB-style files is described here.)

Timeline for d1nkwe_: