Lineage for d1nkwc_ (1nkw C:)

  1. Root: SCOP 1.71
  2. 627044Class i: Low resolution protein structures [58117] (24 folds)
  3. 627045Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 627046Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 627824Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 627828Protein 50S subunit [58125] (3 species)
  7. 627866Species Deinococcus radiodurans [TaxId:1299] [69993] (15 PDB entries)
  8. 627878Domain d1nkwc_: 1nkw C: [80588]

Details for d1nkwc_

PDB Entry: 1nkw (more details), 3.1 Å

PDB Description: Crystal Structure Of The Large Ribosomal Subunit From Deinococcus Radiodurans

SCOP Domain Sequences for d1nkwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nkwc_ i.1.1.2 (C:) 50S subunit {Deinococcus radiodurans}
aqinvigqnggrtielplpevnsgvlhevvtwqlasrrrgtastrtraqvsktgrkmygq
kgtgnarhgdrsvptfvgggvafgpkprsydytlprqvrqlglamaiasrqeggklvavd
gfdiadaktknfiswakqngldgtekvllvtddentrraarnvswvsvlpvagvnvydil
rhdrlvidaaaleivee

SCOP Domain Coordinates for d1nkwc_:

Click to download the PDB-style file with coordinates for d1nkwc_.
(The format of our PDB-style files is described here.)

Timeline for d1nkwc_: