Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.2: Large subunit [58124] (1 protein) |
Protein 50S subunit [58125] (6 species) |
PDB Entry: 1njm (more details), 3.6 Å
SCOPe Domain Sequences for d1njmt_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1njmt_ i.1.1.2 (T:) 50S subunit {Deinococcus radiodurans [TaxId: 1299]} meltakprtpkqkldesmiaavaynkennvsfaldrkafdrafrqqsttglfditvegge tfpalvkavqmdkrkrapihvdfymvtygepvevsvpvhttgrsqgevqgglvdivvhnl qivapgprripqelvvdvtkmnigdhitagdiklpegctlaadpeltvvsvlpprltaee leaevqaaqvaglvaagelseeaaeavlegdasleevkaease
Timeline for d1njmt_: