SCOP 1.69: Domain d1njmt_: 1njm T:

Lineage for d1njmt_ (1njm T:)

1. Root: SCOP 1.69

2. Class i: Low resolution protein structures [58117] (24 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (3 proteins)

6. Protein 50S subunit [58125] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [69993] (15 PDB entries)

8. Domain d1njmt_: 1njm T: [80549]
   complexed with a tRNA acceptor stem mimic (asm) and the antibiotic sparsomycin

Details for d1njmt_

PDB Entry: 1njm, 3.6 Å

PDB Description: The crystal structure of the 50S Large ribosomal subunit from Deinococcus radiodurans complexed with a tRNA acceptor stem mimic (ASM) and the antibiotic sparsomycin

SCOP Domain Sequences for d1njmt_:

Sequence; same for both SEQRES and ATOM records:

>d1njmt_ i.1.1.2 (T:) 50S subunit {Deinococcus radiodurans}
meltakprtpkqkldesmiaavaynkennvsfaldrkafdrafrqqsttglfditvegge
tfpalvkavqmdkrkrapihvdfymvtygepvevsvpvhttgrsqgevqgglvdivvhnl
qivapgprripqelvvdvtkmnigdhitagdiklpegctlaadpeltvvsvlpprltaee
leaevqaaqvaglvaagelseeaaeavlegdasleevkaease

Timeline for d1njmt_:

• d1njmt_ first appeared in SCOP 1.63
  
• d1njmt_ appears in SCOP 1.67
  
• d1njmt_ appears in SCOP 1.71
  
• d1njmt_ appears in the current release, SCOPe 2.08