Lineage for d1nhya2 (1nhy A:1-75)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1368661Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 1369232Protein GST-like domain of elongation factor 1-gamma [82428] (1 species)
  7. 1369233Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82429] (1 PDB entry)
  8. 1369234Domain d1nhya2: 1nhy A:1-75 [80521]
    Other proteins in same PDB: d1nhya1
    complexed with so4

Details for d1nhya2

PDB Entry: 1nhy (more details), 3 Å

PDB Description: crystal structure of the gst-like domain of elongation factor 1-gamma from saccharomyces cerevisiae.
PDB Compounds: (A:) Elongation factor 1-gamma 1

SCOPe Domain Sequences for d1nhya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msqgtlyanfrirtwvprglvkalkldvkvvtpdaaaeqfardfplkkvpafvgpkgykl
teamainyylvklsq

SCOPe Domain Coordinates for d1nhya2:

Click to download the PDB-style file with coordinates for d1nhya2.
(The format of our PDB-style files is described here.)

Timeline for d1nhya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nhya1