| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
| Protein GST-like domain of elongation factor 1-gamma [82428] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82429] (1 PDB entry) |
| Domain d1nhya2: 1nhy A:1-75 [80521] Other proteins in same PDB: d1nhya1 complexed with so4 |
PDB Entry: 1nhy (more details), 3 Å
SCOPe Domain Sequences for d1nhya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msqgtlyanfrirtwvprglvkalkldvkvvtpdaaaeqfardfplkkvpafvgpkgykl
teamainyylvklsq
Timeline for d1nhya2: