Lineage for d1nhya1 (1nhy A:76-219)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1270513Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1270514Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1270515Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1271092Protein GST-like domain of elongation factor 1-gamma [81772] (1 species)
  7. 1271093Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81773] (1 PDB entry)
  8. 1271094Domain d1nhya1: 1nhy A:76-219 [80520]
    Other proteins in same PDB: d1nhya2
    complexed with so4

Details for d1nhya1

PDB Entry: 1nhy (more details), 3 Å

PDB Description: crystal structure of the gst-like domain of elongation factor 1-gamma from saccharomyces cerevisiae.
PDB Compounds: (A:) Elongation factor 1-gamma 1

SCOPe Domain Sequences for d1nhya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ddkmktqllgadddlnaqaqiirwqslansdlciqiantivplkggapynkksvdsamda
vdkivdifenrlknytylatenisladlvaasiftryfeslfgtewraqhpaivrwfntv
raspflkdeykdfkfadkplsppq

SCOPe Domain Coordinates for d1nhya1:

Click to download the PDB-style file with coordinates for d1nhya1.
(The format of our PDB-style files is described here.)

Timeline for d1nhya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nhya2