| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
| Protein GST-like domain of elongation factor 1-gamma [81772] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81773] (1 PDB entry) |
| Domain d1nhya1: 1nhy A:76-219 [80520] Other proteins in same PDB: d1nhya2 complexed with so4 |
PDB Entry: 1nhy (more details), 3 Å
SCOPe Domain Sequences for d1nhya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ddkmktqllgadddlnaqaqiirwqslansdlciqiantivplkggapynkksvdsamda
vdkivdifenrlknytylatenisladlvaasiftryfeslfgtewraqhpaivrwfntv
raspflkdeykdfkfadkplsppq
Timeline for d1nhya1: