Lineage for d1nenb1 (1nen B:107-238)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1718664Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 1718665Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)
  6. 1718694Protein Succinate dehydogenase [81669] (3 species)
  7. 1718705Species Escherichia coli [TaxId:562] [81670] (5 PDB entries)
  8. 1718716Domain d1nenb1: 1nen B:107-238 [80436]
    Other proteins in same PDB: d1nena1, d1nena2, d1nena3, d1nenb2, d1nenc_, d1nend_
    complexed with ca, cdn, dnt, eph, f3s, fad, fes, hem, oaa, sf4

Details for d1nenb1

PDB Entry: 1nen (more details), 2.9 Å

PDB Description: Complex II (Succinate Dehydrogenase) From E. Coli with Dinitrophenol-17 inhibitor co-crystallized at the ubiquinone binding site
PDB Compounds: (B:) Succinate dehydrogenase iron-sulfur protein

SCOPe Domain Sequences for d1nenb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nenb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]}
mgqfyaqyekikpyllnngqnpparehlqmpeqrekldglyecilcaccstscpsfwwnp
dkfigpagllaayrflidsrdtetdsrldglsdafsvfrchsimncvsvcpkglnptrai
ghiksmllqrna

SCOPe Domain Coordinates for d1nenb1:

Click to download the PDB-style file with coordinates for d1nenb1.
(The format of our PDB-style files is described here.)

Timeline for d1nenb1: