Lineage for d1nbfb_ (1nbf B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1398964Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1398965Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1399560Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 proteins)
    Pfam PF00443
  6. 1399574Protein Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) [82569] (1 species)
  7. 1399575Species Human (Homo sapiens) [TaxId:9606] [82570] (2 PDB entries)
  8. 1399577Domain d1nbfb_: 1nbf B: [80388]
    Other proteins in same PDB: d1nbfc_, d1nbfd_
    complex with ubiquitin aldehyde

Details for d1nbfb_

PDB Entry: 1nbf (more details), 2.3 Å

PDB Description: crystal structure of a ubp-family deubiquitinating enzyme in isolation and in complex with ubiquitin aldehyde
PDB Compounds: (B:) Ubiquitin carboxyl-terminal hydrolase 7

SCOPe Domain Sequences for d1nbfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbfb_ d.3.1.9 (B:) Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) {Human (Homo sapiens) [TaxId: 9606]}
kkhtgyvglknqgatcymnsllqtlfftnqlrkavymmptegddssksvplalqrvfyel
qhsdkpvgtkkltksfgwetldsfmqhdvqelcrvlldnvenkmkgtcvegtipklfrgk
mvsyiqckevdyrsdrredyydiqlsikgkknifesfvdyvaveqldgdnkydagehglq
eaekgvkfltlppvlhlqlmrfmydpqtdqnikindrfefpeqlpldeflqktdpkdpan
yilhavlvhsgdnhgghyvvylnpkgdgkwckfdddvvsrctkeeaiehnygghdddlsv
rhctnaymlvyiresklsevlqavtdhdipqqlverlqeekrieaqk

SCOPe Domain Coordinates for d1nbfb_:

Click to download the PDB-style file with coordinates for d1nbfb_.
(The format of our PDB-style files is described here.)

Timeline for d1nbfb_: