![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (23 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 proteins) Pfam PF00443 |
![]() | Protein Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) [82569] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82570] (2 PDB entries) |
![]() | Domain d1nbfb_: 1nbf B: [80388] Other proteins in same PDB: d1nbfc_, d1nbfd_ complex with ubiquitin aldehyde |
PDB Entry: 1nbf (more details), 2.3 Å
SCOPe Domain Sequences for d1nbfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nbfb_ d.3.1.9 (B:) Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) {Human (Homo sapiens) [TaxId: 9606]} kkhtgyvglknqgatcymnsllqtlfftnqlrkavymmptegddssksvplalqrvfyel qhsdkpvgtkkltksfgwetldsfmqhdvqelcrvlldnvenkmkgtcvegtipklfrgk mvsyiqckevdyrsdrredyydiqlsikgkknifesfvdyvaveqldgdnkydagehglq eaekgvkfltlppvlhlqlmrfmydpqtdqnikindrfefpeqlpldeflqktdpkdpan yilhavlvhsgdnhgghyvvylnpkgdgkwckfdddvvsrctkeeaiehnygghdddlsv rhctnaymlvyiresklsevlqavtdhdipqqlverlqeekrieaqk
Timeline for d1nbfb_:
![]() Domains from other chains: (mouse over for more information) d1nbfa_, d1nbfc_, d1nbfd_, d1nbfe_ |