| Class b: All beta proteins [48724] (176 folds) |
| Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
| Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins) forms homo and heteroheptameric ring structures |
| Protein Small nuclear ribonucleoprotein F, Smf [82087] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82088] (2 PDB entries) |
| Domain d1n9ra_: 1n9r A: [80344] |
PDB Entry: 1n9r (more details), 2.8 Å
SCOPe Domain Sequences for d1n9ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n9ra_ b.38.1.1 (A:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lkglvnhrvgvklkfnsteyrgtlvstdnyfnlqlneaeefvagvshgtlgeifircnnv
lyirelpn
Timeline for d1n9ra_: