Lineage for d1n9ra_ (1n9r A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1539176Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1539177Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1539178Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
    forms homo and heteroheptameric ring structures
  6. 1539440Protein Small nuclear ribonucleoprotein F, Smf [82087] (1 species)
  7. 1539441Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82088] (2 PDB entries)
  8. 1539442Domain d1n9ra_: 1n9r A: [80344]

Details for d1n9ra_

PDB Entry: 1n9r (more details), 2.8 Å

PDB Description: Crystal structure of a heptameric ring complex of yeast SmF in spacegroup P4122
PDB Compounds: (A:) Small nuclear ribonucleoprotein F

SCOPe Domain Sequences for d1n9ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n9ra_ b.38.1.1 (A:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lkglvnhrvgvklkfnsteyrgtlvstdnyfnlqlneaeefvagvshgtlgeifircnnv
lyirelpn

SCOPe Domain Coordinates for d1n9ra_:

Click to download the PDB-style file with coordinates for d1n9ra_.
(The format of our PDB-style files is described here.)

Timeline for d1n9ra_: