Lineage for d1n8eb2 (1n8e B:151-199)

  1. Root: SCOP 1.63
  2. 271841Class h: Coiled coil proteins [57942] (6 folds)
  3. 271842Fold h.1: Parallel coiled-coil [57943] (22 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 272214Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) (S)
  5. 272215Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (1 protein)
  6. 272216Protein Fibrinogen coiled-coil and central regions [58012] (4 species)
    in the central region two tripple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  7. 272237Species Human (Homo sapiens) [TaxId:9606] [58013] (10 PDB entries)
  8. 272293Domain d1n8eb2: 1n8e B:151-199 [80289]
    Other proteins in same PDB: d1n8eb1, d1n8ec1, d1n8ee1, d1n8ef1

Details for d1n8eb2

PDB Entry: 1n8e (more details), 4.5 Å

PDB Description: Fragment Double-D from Human Fibrin

SCOP Domain Sequences for d1n8eb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n8eb2 h.1.8.1 (B:151-199) Fibrinogen coiled-coil and central regions {Human (Homo sapiens)}
lyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctv

SCOP Domain Coordinates for d1n8eb2:

Click to download the PDB-style file with coordinates for d1n8eb2.
(The format of our PDB-style files is described here.)

Timeline for d1n8eb2: