SCOP 1.75: Domain d1n86e2: 1n86 E:151-199

Lineage for d1n86e2 (1n86 E:151-199)

1. Root: SCOP 1.75

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
   in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails

6. Protein Fibrinogen beta chain [88892] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88895] (15 PDB entries)
   Uniprot P02675

8. Domain d1n86e2: 1n86 E:151-199 [80284]
   Other proteins in same PDB: d1n86a_, d1n86b1, d1n86c1, d1n86c2, d1n86d_, d1n86e1, d1n86f1, d1n86f2
   coiled-coil region only
   complexed with ca, man, nag

Details for d1n86e2

PDB Entry: 1n86, 3.2 Å

PDB Description: crystal structure of human d-dimer from cross-linked fibrin complexed with gpr and ghrpldk peptide ligands.

PDB Compounds: (E:) Fibrin beta chain

SCOP Domain Sequences for d1n86e2:

Sequence; same for both SEQRES and ATOM records:

>d1n86e2 h.1.8.1 (E:151-199) Fibrinogen beta chain {Human (Homo sapiens) [TaxId: 9606]}
lyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctv

Timeline for d1n86e2:

• d1n86e2 first appeared in SCOP 1.63
  
• d1n86e2 appears in SCOP 1.73
  
• d1n86e2 appears in SCOPe 2.01
  
• d1n86e2 appears in the current release, SCOPe 2.08