| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) ![]() |
| Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins) in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails |
| Protein Fibrinogen beta chain [88892] (4 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88895] (15 PDB entries) Uniprot P02675 |
| Domain d1n86e2: 1n86 E:151-199 [80284] Other proteins in same PDB: d1n86a_, d1n86b1, d1n86c1, d1n86c2, d1n86d_, d1n86e1, d1n86f1, d1n86f2 coiled-coil region only complexed with ca, man, ndg |
PDB Entry: 1n86 (more details), 3.2 Å
SCOPe Domain Sequences for d1n86e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n86e2 h.1.8.1 (E:151-199) Fibrinogen beta chain {Human (Homo sapiens) [TaxId: 9606]}
lyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctv
Timeline for d1n86e2: