SCOP 1.73: Domain d1n86c1: 1n86 C:142-391

Lineage for d1n86c1 (1n86 C:142-391)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
   unusual fold

4. Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (1 family)

5. Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)

6. Protein Fibrinogen C-terminal domains [56498] (7 species)

7. Species Human (Homo sapiens), gamma [TaxId:9606] [68904] (19 PDB entries)

8. Domain d1n86c1: 1n86 C:142-391 [80280]
   Other proteins in same PDB: d1n86a_, d1n86b2, d1n86c2, d1n86d_, d1n86e2, d1n86f2

Details for d1n86c1

PDB Entry: 1n86, 3.2 Å

PDB Description: crystal structure of human d-dimer from cross-linked fibrin complexed with gpr and ghrpldk peptide ligands.

PDB Compounds: (C:) Fibrin gamma chain

SCOP Domain Sequences for d1n86c1:

Sequence; same for both SEQRES and ATOM records:

>d1n86c1 d.171.1.1 (C:142-391) Fibrinogen C-terminal domains {Human (Homo sapiens), gamma [TaxId: 9606]}
tvqihditgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgs
vdfkknwiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstad
yamfkvgpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndk
fegncaeqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkk
ttmkiipfnr

Timeline for d1n86c1:

• d1n86c1 first appeared in SCOP 1.63
  
• d1n86c1 appears in SCOP 1.71
  
• d1n86c1 appears in SCOP 1.75
  
• d1n86c1 appears in the current release, SCOPe 2.08