Lineage for d1n86b2 (1n86 B:151-199)

  1. Root: SCOP 1.73
  2. 752207Class h: Coiled coil proteins [57942] (7 folds)
  3. 752208Fold h.1: Parallel coiled-coil [57943] (33 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 752733Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) (S)
  5. 752734Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 752798Protein Fibrinogen beta chain [88892] (4 species)
  7. 752807Species Human (Homo sapiens) [TaxId:9606] [88895] (15 PDB entries)
  8. 752830Domain d1n86b2: 1n86 B:151-199 [80279]
    Other proteins in same PDB: d1n86a_, d1n86b1, d1n86c1, d1n86c2, d1n86d_, d1n86e1, d1n86f1, d1n86f2

Details for d1n86b2

PDB Entry: 1n86 (more details), 3.2 Å

PDB Description: crystal structure of human d-dimer from cross-linked fibrin complexed with gpr and ghrpldk peptide ligands.
PDB Compounds: (B:) Fibrin beta chain

SCOP Domain Sequences for d1n86b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n86b2 h.1.8.1 (B:151-199) Fibrinogen beta chain {Human (Homo sapiens) [TaxId: 9606]}
lyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctv

SCOP Domain Coordinates for d1n86b2:

Click to download the PDB-style file with coordinates for d1n86b2.
(The format of our PDB-style files is described here.)

Timeline for d1n86b2: