Lineage for d1n69c_ (1n69 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2716976Fold a.64: Saposin-like [47861] (2 superfamilies)
    5 helices; folded leaf, closed
  4. 2716977Superfamily a.64.1: Saposin [47862] (5 families) (S)
    Lipid-binding can promote conformational changes and oligomerisation in some members
  5. 2717020Family a.64.1.3: Saposin B [81806] (2 proteins)
    the alternative subunit conformation is an open four-helical bundle; helices 3 and 4 form a contiguous helix
  6. 2717021Protein Saposin B [81807] (1 species)
  7. 2717022Species Human (Homo sapiens) [TaxId:9606] [81808] (1 PDB entry)
  8. 2717025Domain d1n69c_: 1n69 C: [80120]
    Other proteins in same PDB: d1n69b2
    the alternative subunit conformation
    complexed with 3pe

Details for d1n69c_

PDB Entry: 1n69 (more details), 2.2 Å

PDB Description: crystal structure of human saposin b
PDB Compounds: (C:) saposin b

SCOPe Domain Sequences for d1n69c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n69c_ a.64.1.3 (C:) Saposin B {Human (Homo sapiens) [TaxId: 9606]}
gdvcqdciqmvtdiqtavrtnstfvqalvehvkeecdrlgpgmadicknyisqyseiaiq
mmmhmqpkeicalvgfcd

SCOPe Domain Coordinates for d1n69c_:

Click to download the PDB-style file with coordinates for d1n69c_.
(The format of our PDB-style files is described here.)

Timeline for d1n69c_: