Lineage for d1n63c2 (1n63 C:1-177)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2547890Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2547891Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2547987Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
    automatically mapped to Pfam PF00941
  6. 2547994Protein Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain [56188] (2 species)
  7. 2548000Species Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId:40137] [56189] (5 PDB entries)
  8. 2548005Domain d1n63c2: 1n63 C:1-177 [80107]
    Other proteins in same PDB: d1n63a1, d1n63a2, d1n63b1, d1n63b2, d1n63c1, d1n63d1, d1n63d2, d1n63e1, d1n63e2, d1n63f1
    complexed with cun, fad, fes, mcn, po4

Details for d1n63c2

PDB Entry: 1n63 (more details), 1.21 Å

PDB Description: Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Carbon monoxide reduced state
PDB Compounds: (C:) Carbon monoxide dehydrogenase medium chain

SCOPe Domain Sequences for d1n63c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n63c2 d.145.1.3 (C:1-177) Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]}
mipgsfdyhrpksiadavalltklgedarplagghslipimktrlatpehlvdlrdigdl
vgireegtdvvigamttqhaligsdflaaklpiiretslliadpqirymgtiggnaangd
pgndmpalmqclgaayeltgpegarivaardyyqgayftaiepgelltairipvppt

SCOPe Domain Coordinates for d1n63c2:

Click to download the PDB-style file with coordinates for d1n63c2.
(The format of our PDB-style files is described here.)

Timeline for d1n63c2: