PDB entry 1n63

View 1n63 on RCSB PDB site
Description: Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Carbon monoxide reduced state
Class: oxidoreductase
Keywords: CODH, molybdenum, molybdopterin, oxidoreductase
Deposited on 2002-11-08, released 2002-12-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.21 Å
R-factor: 0.151
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbon monoxide dehydrogenase small chain
    Species: Oligotropha carboxidovorans [TaxId:504832]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1n63a1, d1n63a2
  • Chain 'B':
    Compound: Carbon monoxide dehydrogenase large chain
    Species: Oligotropha carboxidovorans [TaxId:504832]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1n63b1, d1n63b2
  • Chain 'C':
    Compound: Carbon monoxide dehydrogenase medium chain
    Species: Oligotropha carboxidovorans [TaxId:504832]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1n63c1, d1n63c2
  • Chain 'D':
    Compound: Carbon monoxide dehydrogenase small chain
    Species: Oligotropha carboxidovorans [TaxId:504832]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1n63d1, d1n63d2
  • Chain 'E':
    Compound: Carbon monoxide dehydrogenase large chain
    Species: Oligotropha carboxidovorans [TaxId:504832]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1n63e1, d1n63e2
  • Chain 'F':
    Compound: Carbon monoxide dehydrogenase medium chain
    Species: Oligotropha carboxidovorans [TaxId:504832]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1n63f1, d1n63f2
  • Heterogens: PO4, FES, CUN, MCN, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n63A (A:)
    makahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvk
    sctmfavqangasittiegmaapdgtlsalqegfrmmhglqcgyctpgmimrshrllqen
    pspteaeirfgiggnlcrctgyqnivkaiqyaaakingvpfeeaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n63A (A:)
    kahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvksc
    tmfavqangasittiegmaapdgtlsalqegfrmmhglqcgyctpgmimrshrllqenps
    pteaeirfgiggnlcrctgyqnivkaiqyaaakingvpfe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n63B (B:)
    mniqttveptsaeraeklqgmgckrkrvedirftqgkgnyvddvklpgmlfgdfvrssha
    hariksidtskakalpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevaf
    vvakdryvaadaielvevdyeplpvlvdpfkamepdapllredikdkmtgahgarkhhnh
    ifrweigdkegtdatfakaevvskdmftyhrvhpspletcqcvasmdkikgeltlwgtfq
    aphvirtvvslisglpehkihviapdigggfgnkvgaysgyvcavvasivlgvpvkwved
    rmenlsttsfardyhmttelaatkdgkilamrchvladhgafdacadpskwpagfmnict
    gsydmpvahlavdgvytnkasggvayrcsfrvteavyaieraietlaqrlemdsadlrik
    nfiqpeqfpymaplgweydsgnyplamkkamdtvgyhqlraeqkakqeafkrgetreimg
    igisffteivgagpskncdilgvsmfdsaeirihptgsviarmgtksqgqghettyaqii
    atelgipaddimieegntdtapyglgtygsrstptagaatavaarkikakaqmiaahmle
    vhegdlewdvdrfrvkglpekfktmkelawasynspppnlepgleavnyydppnmtypfg
    ayfcimdidvdtgvaktrrfyalddcgtrinpmiiegqvhgglteafavamgqeirydeq
    gnvlgasfmdfflptavetpkwetdytvtpsphhpigakgvgesphvggvpcfsnavnda
    yaflnaghiqmphdawrlwkvgeqlglhv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n63B (B:)
    ttveptsaeraeklqgmgckrkrvedirftqgkgnyvddvklpgmlfgdfvrsshahari
    ksidtskakalpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevafvvak
    dryvaadaielvevdyeplpvlvdpfkamepdapllredikdkmtgahgarkhhnhifrw
    eigdkegtdatfakaevvskdmftyhrvhpspletcqcvasmdkikgeltlwgtfqaphv
    irtvvslisglpehkihviapdigggfgnkvgaysgyvcavvasivlgvpvkwvedrmen
    lsttsfardyhmttelaatkdgkilamrchvladhgafdacadpskwpagfmnictgsyd
    mpvahlavdgvytnkasggvayrcsfrvteavyaieraietlaqrlemdsadlriknfiq
    peqfpymaplgweydsgnyplamkkamdtvgyhqlraeqkakqeafkrgetreimgigis
    ffteivgagpskncdilgvsmfdsaeirihptgsviarmgtksqgqghettyaqiiatel
    gipaddimieegntdtapyglgtygsrstptagaatavaarkikakaqmiaahmlevheg
    dlewdvdrfrvkglpekfktmkelawasynspppnlepgleavnyydppnmtypfgayfc
    imdidvdtgvaktrrfyalddcgtrinpmiiegqvhgglteafavamgqeirydeqgnvl
    gasfmdfflptavetpkwetdytvtpsphhpigakgvgesphvggvpcfsnavndayafl
    naghiqmphdawrlwkvgeqlglhv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1n63C (C:)
    mipgsfdyhrpksiadavalltklgedarplagghslipimktrlatpehlvdlrdigdl
    vgireegtdvvigamttqhaligsdflaaklpiiretslliadpqirymgtiggnaangd
    pgndmpalmqclgaayeltgpegarivaardyyqgayftaiepgelltairipvpptghg
    yayeklkrkigdyataaaavvltmsggkcvtasigltnvantplwaeeagkvlvgtaldk
    paldkavalaeaitapasdgrgpaeyrtkmagvmlrraverakarakn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n63C (C:)
    mipgsfdyhrpksiadavalltklgedarplagghslipimktrlatpehlvdlrdigdl
    vgireegtdvvigamttqhaligsdflaaklpiiretslliadpqirymgtiggnaangd
    pgndmpalmqclgaayeltgpegarivaardyyqgayftaiepgelltairipvpptghg
    yayeklkrkigdyataaaavvltmsggkcvtasigltnvantplwaeeagkvlvgtaldk
    paldkavalaeaitapasdgrgpaeyrtkmagvmlrraverakarak
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1n63D (D:)
    makahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvk
    sctmfavqangasittiegmaapdgtlsalqegfrmmhglqcgyctpgmimrshrllqen
    pspteaeirfgiggnlcrctgyqnivkaiqyaaakingvpfeeaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n63D (D:)
    kahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvksc
    tmfavqangasittiegmaapdgtlsalqegfrmmhglqcgyctpgmimrshrllqenps
    pteaeirfgiggnlcrctgyqnivkaiqyaaakingvp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1n63E (E:)
    mniqttveptsaeraeklqgmgckrkrvedirftqgkgnyvddvklpgmlfgdfvrssha
    hariksidtskakalpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevaf
    vvakdryvaadaielvevdyeplpvlvdpfkamepdapllredikdkmtgahgarkhhnh
    ifrweigdkegtdatfakaevvskdmftyhrvhpspletcqcvasmdkikgeltlwgtfq
    aphvirtvvslisglpehkihviapdigggfgnkvgaysgyvcavvasivlgvpvkwved
    rmenlsttsfardyhmttelaatkdgkilamrchvladhgafdacadpskwpagfmnict
    gsydmpvahlavdgvytnkasggvayrcsfrvteavyaieraietlaqrlemdsadlrik
    nfiqpeqfpymaplgweydsgnyplamkkamdtvgyhqlraeqkakqeafkrgetreimg
    igisffteivgagpskncdilgvsmfdsaeirihptgsviarmgtksqgqghettyaqii
    atelgipaddimieegntdtapyglgtygsrstptagaatavaarkikakaqmiaahmle
    vhegdlewdvdrfrvkglpekfktmkelawasynspppnlepgleavnyydppnmtypfg
    ayfcimdidvdtgvaktrrfyalddcgtrinpmiiegqvhgglteafavamgqeirydeq
    gnvlgasfmdfflptavetpkwetdytvtpsphhpigakgvgesphvggvpcfsnavnda
    yaflnaghiqmphdawrlwkvgeqlglhv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n63E (E:)
    aeklqgmgckrkrvedirftqgkgnyvddvklpgmlfgdfvrsshahariksidtskaka
    lpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevafvvakdryvaadaie
    lvevdyeplpvlvdpfkamepdapllredikdkmtgahgarkhhnhifrweigdkegtda
    tfakaevvskdmftyhrvhpspletcqcvasmdkikgeltlwgtfqaphvirtvvslisg
    lpehkihviapdigggfgnkvgaysgyvcavvasivlgvpvkwvedrmenlsttsfardy
    hmttelaatkdgkilamrchvladhgafdacadpskwpagfmnictgsydmpvahlavdg
    vytnkasggvayrcsfrvteavyaieraietlaqrlemdsadlriknfiqpeqfpymapl
    gweydsgnyplamkkamdtvgyhqlraeqkakqeafkrgetreimgigisffteivgagp
    skncdilgvsmfdsaeirihptgsviarmgtksqgqghettyaqiiatelgipaddimie
    egntdtapyglgtygsrstptagaatavaarkikakaqmiaahmlevhegdlewdvdrfr
    vkglpekfktmkelawasynspppnlepgleavnyydppnmtypfgayfcimdidvdtgv
    aktrrfyalddcgtrinpmiiegqvhgglteafavamgqeirydeqgnvlgasfmdfflp
    tavetpkwetdytvtpsphhpigakgvgesphvggvpcfsnavndayaflnaghiqmphd
    awrlwkvgeqlglhv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1n63F (F:)
    mipgsfdyhrpksiadavalltklgedarplagghslipimktrlatpehlvdlrdigdl
    vgireegtdvvigamttqhaligsdflaaklpiiretslliadpqirymgtiggnaangd
    pgndmpalmqclgaayeltgpegarivaardyyqgayftaiepgelltairipvpptghg
    yayeklkrkigdyataaaavvltmsggkcvtasigltnvantplwaeeagkvlvgtaldk
    paldkavalaeaitapasdgrgpaeyrtkmagvmlrraverakarakn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n63F (F:)
    mipgsfdyhrpksiadavalltklgedarplagghslipimktrlatpehlvdlrdigdl
    vgireegtdvvigamttqhaligsdflaaklpiiretslliadpqirymgtiggnaangd
    pgndmpalmqclgaayeltgpegarivaardyyqgayftaiepgelltairipvpptghg
    yayeklkrkigdyataaaavvltmsggkcvtasigltnvantplwaeeagkvlvgtaldk
    paldkavalaeaitapasdgrgpaeyrtkmagvmlrraverakara