Lineage for d1n5tb_ (1n5t B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2556580Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2556638Family d.58.4.3: Actinorhodin biosynthesis monooxygenase ActVa-Orf6 [82666] (1 protein)
  6. 2556639Protein Actinorhodin biosynthesis monooxygenase ActVa-Orf6 [82667] (1 species)
  7. 2556640Species Streptomyces coelicolor [TaxId:1902] [82668] (5 PDB entries)
  8. 2556648Domain d1n5tb_: 1n5t B: [80042]
    complexed with oal

Details for d1n5tb_

PDB Entry: 1n5t (more details), 1.9 Å

PDB Description: Crystal structure of a Monooxygenase from the gene ActVA-Orf6 of Streptomyces coelicolor in complex with the ligand Oxidized Acetyl Dithranol
PDB Compounds: (B:) actva-orf6 monooxygenase

SCOPe Domain Sequences for d1n5tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5tb_ d.58.4.3 (B:) Actinorhodin biosynthesis monooxygenase ActVa-Orf6 {Streptomyces coelicolor [TaxId: 1902]}
aevndprvgfvavvtfpvdgpatqhklvelatggvqewirevpgflsatyhastdgtavv
nyaqweseqayrvnfgadprsaelrealsslpglmgppkavfmtprgailps

SCOPe Domain Coordinates for d1n5tb_:

Click to download the PDB-style file with coordinates for d1n5tb_.
(The format of our PDB-style files is described here.)

Timeline for d1n5tb_: