Class a: All alpha proteins [46456] (286 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.3: Retinoblastoma tumor suppressor domains [47969] (1 protein) |
Protein Retinoblastoma tumor suppressor domains [47970] (1 species) contains an additional C-terminal helix |
Species Human (Homo sapiens) [TaxId:9606] [47971] (7 PDB entries) |
Domain d1n4mb1: 1n4m B:380-581 [79996] bound to the transactivation domain (peptide) of E2F-2 |
PDB Entry: 1n4m (more details), 2.2 Å
SCOPe Domain Sequences for d1n4mb1:
Sequence, based on SEQRES records: (download)
>d1n4mb1 a.74.1.3 (B:380-581) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]} ntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgagcv aigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmatys rstsqnldsgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrime slawlsdsplfdlikqsktreg
>d1n4mb1 a.74.1.3 (B:380-581) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]} ntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgagcv aigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmatys rsttdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrimeslawlsd splfdlikqsktreg
Timeline for d1n4mb1: