Lineage for d1n32c1 (1n32 C:2-106)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947226Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 2947289Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 2947290Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)
  6. 2947306Protein Ribosomal protein S3 N-terminal domain [54816] (4 species)
  7. 2947336Species Thermus thermophilus [TaxId:274] [54817] (36 PDB entries)
    Uniprot P80372
  8. 2947351Domain d1n32c1: 1n32 C:2-106 [79870]
    Other proteins in same PDB: d1n32b_, d1n32c2, d1n32d_, d1n32e1, d1n32e2, d1n32f_, d1n32g_, d1n32h_, d1n32i_, d1n32j_, d1n32k_, d1n32l_, d1n32m_, d1n32n_, d1n32o_, d1n32p_, d1n32q_, d1n32r_, d1n32s_, d1n32t_, d1n32v_
    complexed with mg, par, zn

Details for d1n32c1

PDB Entry: 1n32 (more details), 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d1n32c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n32c1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus [TaxId: 274]}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev

SCOPe Domain Coordinates for d1n32c1:

Click to download the PDB-style file with coordinates for d1n32c1.
(The format of our PDB-style files is described here.)

Timeline for d1n32c1: