Lineage for d1n32b_ (1n32 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2466923Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) (S)
    fold elaborated with additional structures
  5. 2466924Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)
  6. 2466925Protein Ribosomal protein S2 [52315] (3 species)
  7. 2466962Species Thermus thermophilus [TaxId:274] [52316] (46 PDB entries)
    Uniprot P80371
  8. 2466967Domain d1n32b_: 1n32 B: [79869]
    Other proteins in same PDB: d1n32c1, d1n32c2, d1n32d_, d1n32e1, d1n32e2, d1n32f_, d1n32g_, d1n32h_, d1n32i_, d1n32j_, d1n32k_, d1n32l_, d1n32m_, d1n32n_, d1n32o_, d1n32p_, d1n32q_, d1n32r_, d1n32s_, d1n32t_, d1n32v_
    complexed with mg, par, zn

Details for d1n32b_

PDB Entry: 1n32 (more details), 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
PDB Compounds: (B:) 30S ribosomal protein S2

SCOPe Domain Sequences for d1n32b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n32b_ c.23.15.1 (B:) Ribosomal protein S2 {Thermus thermophilus [TaxId: 274]}
vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe
ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia
ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq

SCOPe Domain Coordinates for d1n32b_:

Click to download the PDB-style file with coordinates for d1n32b_.
(The format of our PDB-style files is described here.)

Timeline for d1n32b_: