Lineage for d1n21a2 (1n21 A:271-598)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 217826Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 217827Superfamily a.128.1: Terpenoid synthases [48576] (5 families) (S)
    duplication: two metal-binding sites are related by a pseudodyad that also relates helices C-F to helices G-J
  5. 217842Family a.128.1.3: Terpenoid cyclase C-terminal domain [48583] (2 proteins)
  6. 217843Protein (+)-bornyl diphosphate synthase [81920] (1 species)
  7. 217844Species Garden sage (Salvia officinalis) [TaxId:38868] [81921] (7 PDB entries)
  8. 217857Domain d1n21a2: 1n21 A:271-598 [79837]
    Other proteins in same PDB: d1n21a1
    complexed with 3ag, mg

Details for d1n21a2

PDB Entry: 1n21 (more details), 3.1 Å

PDB Description: (+)-Bornyl Diphosphate Synthase: Cocrystal with Mg and 3-aza-2,3-dihydrogeranyl diphosphate

SCOP Domain Sequences for d1n21a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n21a2 a.128.1.3 (A:271-598) (+)-bornyl diphosphate synthase {Garden sage (Salvia officinalis)}
mnplifelaklnfniiqathqqelkdlsrwwsrlcfpeklpfvrdrlvesffwavgmfep
hqhgyqrkmaatiivlatviddiydvygtldelelftdtfkrwdtesitrlpyymqlcyw
gvhnyisdaaydilkehgffclqylrksvvdlveayfheakwyhsgytpsldeylniaki
svaspaiisptyftfanashdtavidslyqyhdilclagiilrlpddlgtsyfelargdv
pktiqcymketnaseeeavehvkflireawkdmntaiaagypfpdgmvagaanigrvaqf
iylhgdgfgvqhsktyehiagllfepya

SCOP Domain Coordinates for d1n21a2:

Click to download the PDB-style file with coordinates for d1n21a2.
(The format of our PDB-style files is described here.)

Timeline for d1n21a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n21a1