SCOPe 2.07: Domain d1n1zb1: 1n1z B:65-270

Lineage for d1n1zb1 (1n1z B:65-270)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.1: Terpenoid cyclase N-terminal domain [48240] (3 proteins)
   incomplete toroid made of four hairpins
   automatically mapped to Pfam PF01397

6. Protein (+)-bornyl diphosphate synthase [81857] (1 species)

7. Species Garden sage (Salvia officinalis) [TaxId:38868] [81858] (7 PDB entries)

8. Domain d1n1zb1: 1n1z B:65-270 [79830]
   Other proteins in same PDB: d1n1za2, d1n1zb2
   complexed with btb, mg, pop

Details for d1n1zb1

PDB Entry: 1n1z, 2.3 Å

PDB Description: (+)-Bornyl Diphosphate Synthase: Complex with Mg and pyrophosphate

PDB Compounds: (B:) (+)-bornyl diphosphate synthase

SCOPe Domain Sequences for d1n1zb1:

Sequence, based on SEQRES records:

>d1n1zb1 a.102.4.1 (B:65-270) (+)-bornyl diphosphate synthase {Garden sage (Salvia officinalis) [TaxId: 38868]}
wdsnyiqslntpyteerhldrkaelivqvrillkekmepvqqlelihdlkylglsdffqd
eikeilgviynehkcfhnnevekmdlyftalgfrllrqhgfnisqdvfncfknekgidfk
aslaqdtkgmlqlyeasfllrkgedtlelarefatkclqkkldeggneidenlllwirhs
ldlplhwriqsvearwfidayarrpd

Sequence, based on observed residues (ATOM records):

>d1n1zb1 a.102.4.1 (B:65-270) (+)-bornyl diphosphate synthase {Garden sage (Salvia officinalis) [TaxId: 38868]}
wdsnyiqslntpyteerhldrkaelivqvrillkekmepvqqlelihdlkylglsdffqd
eikeilgviynehkcfhmdlyftalgfrllrqhgfnisqdvfncfknekgidfkaslaqd
tkgmlqlyeasfllrkgedtlelarefatkclqkkldeeidenlllwirhsldlplhwri
qsvearwfidayarrpd

Timeline for d1n1zb1:

• d1n1zb1 first appeared in SCOP 1.63
  
• d1n1zb1 appears in SCOPe 2.06
  
• d1n1zb1 appears in the current release, SCOPe 2.08