Lineage for d1n1ic1 (1n1i C:9-51)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1061532Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1062283Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 1062735Family g.3.11.4: Merozoite surface protein 1 (MSP-1) [57239] (1 protein)
  6. 1062736Protein Merozoite surface protein 1 (MSP-1) [57240] (3 species)
  7. 1062748Species Malaria parasite (Plasmodium knowlesi) [TaxId:5850] [82892] (1 PDB entry)
  8. 1062753Domain d1n1ic1: 1n1i C:9-51 [79809]
    complexed with his, imd

Details for d1n1ic1

PDB Entry: 1n1i (more details), 2.4 Å

PDB Description: The structure of MSP-1(19) from Plasmodium knowlesi
PDB Compounds: (C:) Merozoite surface protein-1

SCOPe Domain Sequences for d1n1ic1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n1ic1 g.3.11.4 (C:9-51) Merozoite surface protein 1 (MSP-1) {Malaria parasite (Plasmodium knowlesi) [TaxId: 5850]}
sahkcidtnvpenaacyryldgteewrcllgfkevggkcvpas

SCOPe Domain Coordinates for d1n1ic1:

Click to download the PDB-style file with coordinates for d1n1ic1.
(The format of our PDB-style files is described here.)

Timeline for d1n1ic1: