SCOP 1.63: Domain d1n1bb1: 1n1b B:62-270

Lineage for d1n1bb1 (1n1b B:62-270)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array

4. Superfamily a.102.4: Terpenoid cylases/Protein prenyltransferases [48239] (4 families)

5. Family a.102.4.1: Terpenoid cylase N-terminal domain [48240] (2 proteins)
   incomlete toroid made of four haipins

6. Protein (+)-bornyl diphosphate synthase [81857] (1 species)

7. Species Garden sage (Salvia officinalis) [TaxId:38868] [81858] (7 PDB entries)

8. Domain d1n1bb1: 1n1b B:62-270 [79801]
   Other proteins in same PDB: d1n1ba2, d1n1bb2
   complexed with hg, mg

Details for d1n1bb1

PDB Entry: 1n1b, 2 Å

PDB Description: crystal structure of (+)-bornyl diphosphate synthase from sage

SCOP Domain Sequences for d1n1bb1:

Sequence, based on SEQRES records:

>d1n1bb1 a.102.4.1 (B:62-270) (+)-bornyl diphosphate synthase {Garden sage (Salvia officinalis)}
palwdsnyiqslntpyteerhldrkaelivqvrillkekmepvqqlelihdlkylglsdf
fqdeikeilgviynehkcfhnnevekmdlyftalgfrllrqhgfnisqdvfncfknekgi
dfkaslaqdtkgmlqlyeasfllrkgedtlelarefatkclqkkldeggneidenlllwi
rhsldlplhwriqsvearwfidayarrpd

Sequence, based on observed residues (ATOM records):

>d1n1bb1 a.102.4.1 (B:62-270) (+)-bornyl diphosphate synthase {Garden sage (Salvia officinalis)}
palwdsnyiqslntpyteerhldrkaelivqvrillkekmepvqqlelihdlkylglsdf
fqdeikeilgviynehkcfhnnevekmdlyftalgfrllrqhgfnisqdvfncfknekgi
dfkaslaqdtkgmlqlyeasfllrkgedtlelarefatkclqkklddenlllwirhsldl
plhwriqsvearwfidayarrpd

Timeline for d1n1bb1:

• d1n1bb1 is new in SCOP 1.63
  
• d1n1bb1 appears in SCOP 1.65
  
• d1n1bb1 appears in the current release, SCOPe 2.08