Lineage for d1n0jb2 (1n0j B:84-198)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722119Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 722120Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 722121Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 722247Protein Mn superoxide dismutase (MnSOD) [54721] (7 species)
  7. 722300Species Human (Homo sapiens) [TaxId:9606] [54724] (23 PDB entries)
  8. 722330Domain d1n0jb2: 1n0j B:84-198 [79743]
    Other proteins in same PDB: d1n0ja1, d1n0jb1
    complexed with mn; mutant

Details for d1n0jb2

PDB Entry: 1n0j (more details), 2.2 Å

PDB Description: the structure of human mitochondrial mn3+ superoxide dismutase reveals a novel tetrameric interface of two 4-helix bundles
PDB Compounds: (B:) Superoxide dismutase [Mn]

SCOP Domain Sequences for d1n0jb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n0jb2 d.44.1.1 (B:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

SCOP Domain Coordinates for d1n0jb2:

Click to download the PDB-style file with coordinates for d1n0jb2.
(The format of our PDB-style files is described here.)

Timeline for d1n0jb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n0jb1