Lineage for d1n06b_ (1n06 B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543994Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1544703Superfamily b.43.5: Riboflavin kinase-like [82114] (3 families) (S)
  5. 1544704Family b.43.5.1: ATP-dependent riboflavin kinase-like [82115] (2 proteins)
    automatically mapped to Pfam PF01687
  6. 1544705Protein Riboflavin kinase [82116] (2 species)
  7. 1544706Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [82117] (4 PDB entries)
  8. 1544710Domain d1n06b_: 1n06 B: [79727]
    complexed with adp

Details for d1n06b_

PDB Entry: 1n06 (more details), 2 Å

PDB Description: Crystal Structure of Schizosaccharomyces pombe Riboflavin Kinase Reveals a Novel ATP and Riboflavin Binding Fold
PDB Compounds: (B:) putative riboflavin kinase

SCOPe Domain Sequences for d1n06b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n06b_ b.43.5.1 (B:) Riboflavin kinase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
krpeivgpekvqspypirfegkvvhgfgrgskelgiptanisedaiqellryrdsgvyfg
yamvqkrvfpmvmsvgwnpyyknklrsaevhlierqgedfyeeimrvivlgyirpelnya
gldkliedihtdirvalnsmdrpsyssykkdpffk

SCOPe Domain Coordinates for d1n06b_:

Click to download the PDB-style file with coordinates for d1n06b_.
(The format of our PDB-style files is described here.)

Timeline for d1n06b_: