Lineage for d1mzga1 (1mzg A:3-138)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564311Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 2564312Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 2564313Family d.224.1.1: SufE-like [82650] (3 proteins)
    Fe-S metabolism associated domain
    automatically mapped to Pfam PF02657
  6. 2564317Protein SufE (YhnA) [82651] (1 species)
    unknown function; probably involved in Fe-S center assembly
  7. 2564318Species Escherichia coli [TaxId:562] [82652] (1 PDB entry)
  8. 2564319Domain d1mzga1: 1mzg A:3-138 [79696]
    Other proteins in same PDB: d1mzga2, d1mzgb2
    structural genomics

Details for d1mzga1

PDB Entry: 1mzg (more details), 2 Å

PDB Description: X-Ray Structure of SufE from E.coli Northeast Structural Genomics (NESG) Consortium Target ER30
PDB Compounds: (A:) SufE Protein

SCOPe Domain Sequences for d1mzga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mzga1 d.224.1.1 (A:3-138) SufE (YhnA) {Escherichia coli [TaxId: 562]}
llpdkekllrnflrcanweekylyiielgqrlpelrdedrspqnsiqgcqsqvwivmrqn
aqgiielqgdsdaaivkgliavvfilydqmtpqdivnfdvrpwfekmaltqhltpsrsqg
leamirairakaaals

SCOPe Domain Coordinates for d1mzga1:

Click to download the PDB-style file with coordinates for d1mzga1.
(The format of our PDB-style files is described here.)

Timeline for d1mzga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mzga2