PDB entry 1mzg

View 1mzg on RCSB PDB site
Description: X-Ray Structure of SufE from E.coli Northeast Structural Genomics (NESG) Consortium Target ER30
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, UNKNOWN FUNCTION, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG
Deposited on 2002-10-07, released 2003-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.208
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SufE Protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76194 (Start-137)
      • modified residue (58)
      • modified residue (91)
      • modified residue (108)
      • modified residue (125)
      • expression tag (138-145)
    Domains in SCOPe 2.07: d1mzga1, d1mzga2
  • Chain 'B':
    Compound: SufE Protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76194 (Start-137)
      • modified residue (58)
      • modified residue (91)
      • modified residue (108)
      • modified residue (125)
      • expression tag (138-143)
    Domains in SCOPe 2.07: d1mzgb1, d1mzgb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mzgA (A:)
    mallpdkekllrnflrcanweekylyiielgqrlpelrdedrspqnsiqgcqsqvwivmr
    qnaqgiielqgdsdaaivkgliavvfilydqmtpqdivnfdvrpwfekmaltqhltpsrs
    qgleamirairakaaalslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mzgA (A:)
    llpdkekllrnflrcanweekylyiielgqrlpelrdedrspqnsiqgcqsqvwivmrqn
    aqgiielqgdsdaaivkgliavvfilydqmtpqdivnfdvrpwfekmaltqhltpsrsqg
    leamirairakaaalslehhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mzgB (B:)
    mallpdkekllrnflrcanweekylyiielgqrlpelrdedrspqnsiqgcqsqvwivmr
    qnaqgiielqgdsdaaivkgliavvfilydqmtpqdivnfdvrpwfekmaltqhltpsrs
    qgleamirairakaaalslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mzgB (B:)
    allpdkekllrnflrcanweekylyiielgqrlpelrdedrspqnsiqgcqsqvwivmrq
    naqgiielqgdsdaaivkgliavvfilydqmtpqdivnfdvrpwfekmaltqhltpsrsq
    gleamirairakaaalslehhhh