![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein Granzyme K [82124] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82125] (2 PDB entries) |
![]() | Domain d1mzaa_: 1mza A: [79692] proenzyme |
PDB Entry: 1mza (more details), 2.23 Å
SCOPe Domain Sequences for d1mzaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} meiiggkevsphsrpfmasiqygghhvcggvlidpqwvltaahcqyrftkgqsptvvlga hslskneaskqtleikkfipfsrvtsdpqsndimlvklqtaaklnkhvkmlhirsktslr sgtkckvtgwgatdpdslrpsdtlrevtvtvlsrklcnsqsyyngdpfitkdmvcagdak gqkdsckgdaggplickgvfhaivsgghecgvatkpgiytlltkkyqtwiksnlvpphtn
Timeline for d1mzaa_: