![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (7 proteins) subgroup of the larger IPT/TIG domain family |
![]() | Protein p65 subunit of NF-kappa B (NFKB), dimerization domain [49253] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49255] (3 PDB entries) |
![]() | Domain d1my7b_: 1my7 B: [79676] mutant |
PDB Entry: 1my7 (more details), 1.49 Å
SCOPe Domain Sequences for d1my7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1my7b_ b.1.18.1 (B:) p65 subunit of NF-kappa B (NFKB), dimerization domain {Human (Homo sapiens) [TaxId: 9606]} taelkicrvnrrsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvai vfrtppyadpslqapvrvsmqlrrpsdrelsepmefqylpdt
Timeline for d1my7b_: