Lineage for d1my5b_ (1my5 B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 367734Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 367735Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (5 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 367758Protein p65 subunit of NF-kappa B (NFKB), dimerization domain [49253] (3 species)
  7. 367762Species Human (Homo sapiens) [TaxId:9606] [49255] (3 PDB entries)
  8. 367766Domain d1my5b_: 1my5 B: [79674]

Details for d1my5b_

PDB Entry: 1my5 (more details), 1.8 Å

PDB Description: NF-kappaB p65 subunit dimerization domain homodimer

SCOP Domain Sequences for d1my5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1my5b_ b.1.18.1 (B:) p65 subunit of NF-kappa B (NFKB), dimerization domain {Human (Homo sapiens)}
taelkicrvnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvai
vfrtppyadpslqapvrvsmqlrrpsdrelsepmefqylpd

SCOP Domain Coordinates for d1my5b_:

Click to download the PDB-style file with coordinates for d1my5b_.
(The format of our PDB-style files is described here.)

Timeline for d1my5b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1my5a_