SCOP 1.65: Domain d1my5b_: 1my5 B:

Lineage for d1my5b_ (1my5 B:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (5 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein p65 subunit of NF-kappa B (NFKB), dimerization domain [49253] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49255] (3 PDB entries)

8. Domain d1my5b_: 1my5 B: [79674]

Details for d1my5b_

PDB Entry: 1my5, 1.8 Å

PDB Description: NF-kappaB p65 subunit dimerization domain homodimer

SCOP Domain Sequences for d1my5b_:

Sequence; same for both SEQRES and ATOM records:

>d1my5b_ b.1.18.1 (B:) p65 subunit of NF-kappa B (NFKB), dimerization domain {Human (Homo sapiens)}
taelkicrvnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvai
vfrtppyadpslqapvrvsmqlrrpsdrelsepmefqylpd

Timeline for d1my5b_:

• d1my5b_ first appeared in SCOP 1.63
  
• d1my5b_ appears in SCOP 1.67
  
• d1my5b_ appears in the current release, SCOPe 2.08