Lineage for d1mx4a_ (1mx4 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2238947Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 2238948Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 2238949Family d.211.1.1: Ankyrin repeat [48404] (19 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 2239014Protein p18ink4C(ink6) [48412] (1 species)
  7. 2239015Species Human (Homo sapiens) [TaxId:9606] [48413] (6 PDB entries)
  8. 2239018Domain d1mx4a_: 1mx4 A: [79640]

Details for d1mx4a_

PDB Entry: 1mx4 (more details), 2 Å

PDB Description: structure of p18ink4c (f82q)
PDB Compounds: (A:) cyclin-dependent kinase 6 inhibitor

SCOPe Domain Sequences for d1mx4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mx4a_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]}
wgnelasaaargdleqltsllqnnvnvnaqngfgrtalqvmklgnpeiarrlllrganpd
lkdrtgfavihdaaragqldtlqtllefqadvniednegnlplhlaakeghlrvveflvk
htasnvghrnhkgdtacdlarlygrnevvslmqang

SCOPe Domain Coordinates for d1mx4a_:

Click to download the PDB-style file with coordinates for d1mx4a_.
(The format of our PDB-style files is described here.)

Timeline for d1mx4a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mx4b_