Class a: All alpha proteins [46456] (286 folds) |
Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) contains a helix-two turns-helix (H2TH) motif |
Family a.156.1.3: Topoisomerase VI-B subunit middle domain [81705] (1 protein) automatically mapped to Pfam PF05833 |
Protein Topoisomerase VI-B subunit middle domain [81706] (1 species) |
Species Sulfolobus shibatae [TaxId:2286] [81707] (7 PDB entries) |
Domain d1mx0e1: 1mx0 E:229-306 [79630] Other proteins in same PDB: d1mx0a2, d1mx0a3, d1mx0b2, d1mx0b3, d1mx0c2, d1mx0c3, d1mx0d2, d1mx0d3, d1mx0e2, d1mx0e3, d1mx0f2, d1mx0f3 complexed with anp, mg, na |
PDB Entry: 1mx0 (more details), 2.3 Å
SCOPe Domain Sequences for d1mx0e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mx0e1 a.156.1.3 (E:229-306) Topoisomerase VI-B subunit middle domain {Sulfolobus shibatae [TaxId: 2286]} vkphpygvdreeikilinnlkrdytikeflvnefqsigdttadkilelaglkpnkkvknl teeeitrlvetfkkyedf
Timeline for d1mx0e1: