Lineage for d1mx0b2 (1mx0 B:307-458)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1401399Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1401400Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1401595Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (6 proteins)
  6. 1401630Protein Topoisomerase VI-B subunit [82577] (1 species)
    contains an H2TH domain inserted in front of this domain and after the N-terminal ATPase domain
  7. 1401631Species Sulfolobus shibatae [TaxId:2286] [82578] (7 PDB entries)
  8. 1401642Domain d1mx0b2: 1mx0 B:307-458 [79622]
    Other proteins in same PDB: d1mx0a1, d1mx0a3, d1mx0b1, d1mx0b3, d1mx0c1, d1mx0c3, d1mx0d1, d1mx0d3, d1mx0e1, d1mx0e3, d1mx0f1, d1mx0f3
    complexed with anp, mg, na

Details for d1mx0b2

PDB Entry: 1mx0 (more details), 2.3 Å

PDB Description: Structure of topoisomerase subunit
PDB Compounds: (B:) Type II DNA topoisomerase VI subunit B

SCOPe Domain Sequences for d1mx0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mx0b2 d.14.1.3 (B:307-458) Topoisomerase VI-B subunit {Sulfolobus shibatae [TaxId: 2286]}
rspsadslsvigedlielglkkifnpdfaasitrkpkayqghpfiveagvafggsipvge
epivlryankipliydeksdviwkvveeldwkrygiesdqyqmvvmvhlcstkipyksag
kesiaevediekeiknalmevarklkqylsek

SCOPe Domain Coordinates for d1mx0b2:

Click to download the PDB-style file with coordinates for d1mx0b2.
(The format of our PDB-style files is described here.)

Timeline for d1mx0b2: