| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
| Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (6 proteins) |
| Protein Topoisomerase VI-B subunit [82577] (1 species) contains an H2TH domain inserted in front of this domain and after the N-terminal ATPase domain |
| Species Sulfolobus shibatae [TaxId:2286] [82578] (7 PDB entries) |
| Domain d1mx0a2: 1mx0 A:307-467 [79619] Other proteins in same PDB: d1mx0a1, d1mx0a3, d1mx0b1, d1mx0b3, d1mx0c1, d1mx0c3, d1mx0d1, d1mx0d3, d1mx0e1, d1mx0e3, d1mx0f1, d1mx0f3 complexed with anp, mg, na |
PDB Entry: 1mx0 (more details), 2.3 Å
SCOPe Domain Sequences for d1mx0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mx0a2 d.14.1.3 (A:307-467) Topoisomerase VI-B subunit {Sulfolobus shibatae [TaxId: 2286]}
rspsadslsvigedlielglkkifnpdfaasitrkpkayqghpfiveagvafggsipvge
epivlryankipliydeksdviwkvveeldwkrygiesdqyqmvvmvhlcstkipyksag
kesiaevediekeiknalmevarklkqylsekrkeqeakkk
Timeline for d1mx0a2: