SCOPe 2.07: Domain d1mwua2: 1mwu A:139-327

Lineage for d1mwua2 (1mwu A:139-327)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
   unusual fold

4. Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families)
   automatically mapped to Pfam PF03717

5. Family d.175.1.1: Penicillin binding protein dimerisation domain [56520] (2 proteins)
   contains an insert subdomain of ClpS-like fold

6. Protein Penicillin binding protein 2a (PBP2A), middle domain [82824] (1 species)
   the insert subdomain (residues 168-239) is fully ordered

7. Species Staphylococcus aureus [TaxId:1280] [82825] (10 PDB entries)
   Uniprot O54286 27-668

8. Domain d1mwua2: 1mwu A:139-327 [79605]
   Other proteins in same PDB: d1mwua1, d1mwua3, d1mwub1, d1mwub3
   complexed with 7ep, cd, cl

Details for d1mwua2

PDB Entry: 1mwu, 2.6 Å

PDB Description: Structure of methicillin acyl-Penicillin binding protein 2a from methicillin resistant Staphylococcus aureus strain 27r at 2.60 A resolution.

PDB Compounds: (A:) penicillin-binding protein 2a

SCOPe Domain Sequences for d1mwua2:

Sequence; same for both SEQRES and ATOM records:

>d1mwua2 d.175.1.1 (A:139-327) Penicillin binding protein 2a (PBP2A), middle domain {Staphylococcus aureus [TaxId: 1280]}
dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk
kdgkdiqlt

Timeline for d1mwua2:

• d1mwua2 first appeared in SCOP 1.63
  
• d1mwua2 appears in SCOPe 2.06
  
• d1mwua2 appears in the current release, SCOPe 2.08