![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.5: Penicillin binding protein 2a (PBP2A), N-terminal domain [82595] (1 protein) some sequence similarity to KSI automatically mapped to Pfam PF05223 |
![]() | Protein Penicillin binding protein 2a (PBP2A), N-terminal domain [82596] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [82597] (10 PDB entries) Uniprot O54286 27-668 |
![]() | Domain d1mwsa1: 1mws A:27-138 [79592] Other proteins in same PDB: d1mwsa2, d1mwsa3, d1mwsb2, d1mwsb3 complexed with cd, cl |
PDB Entry: 1mws (more details), 2 Å
SCOPe Domain Sequences for d1mwsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mwsa1 d.17.4.5 (A:27-138) Penicillin binding protein 2a (PBP2A), N-terminal domain {Staphylococcus aureus [TaxId: 1280]} dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk
Timeline for d1mwsa1: