Lineage for d1mwka1 (1mwk A:1-157)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2137194Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2137195Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2137555Protein Plasmid segregation protein ParM [82438] (1 species)
  7. 2137556Species Escherichia coli [TaxId:562] [82439] (6 PDB entries)
  8. 2137569Domain d1mwka1: 1mwk A:1-157 [79576]

Details for d1mwka1

PDB Entry: 1mwk (more details), 2.3 Å

PDB Description: ParM from plasmid R1 APO form
PDB Compounds: (A:) ParM

SCOPe Domain Sequences for d1mwka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwka1 c.55.1.1 (A:1-157) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]}
mlvfiddgstniklqwqesdgtikqhispnsfkrewavsfgdkkvfnytlngeqysfdpi
spdavvttniawqysdvnvvavhhalltsglpvsevdivctlplteyydrnnqpntenie
rkkanfrkkitlnggdtftikdvkvmpesipagyevl

SCOPe Domain Coordinates for d1mwka1:

Click to download the PDB-style file with coordinates for d1mwka1.
(The format of our PDB-style files is described here.)

Timeline for d1mwka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mwka2