Lineage for d1mw3a2 (1mw3 A:5-554)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2081497Family c.1.8.1: Amylase, catalytic domain [51446] (26 protein domains)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2081525Protein Amylosucrase [69384] (1 species)
  7. 2081526Species Neisseria polysaccharea [TaxId:489] [69385] (10 PDB entries)
  8. 2081532Domain d1mw3a2: 1mw3 A:5-554 [79556]
    Other proteins in same PDB: d1mw3a1, d1mw3a3
    complexed with suc, trs

Details for d1mw3a2

PDB Entry: 1mw3 (more details), 2 Å

PDB Description: amylosucrase soaked with 1m sucrose
PDB Compounds: (A:) amylosucrase

SCOPe Domain Sequences for d1mw3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mw3a2 c.1.8.1 (A:5-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]}
qylktrildiytpeqragieksedwrqfsrrmdthfpklmneldsvygnneallpmleml
laqawqsysqrnsslkdidiarennpdwilsnkqvggvcyvdlfagdlkglkdkipyfqe
lgltylhlmplfkcpegksdggyavssyrdvnpalgtigdlreviaalheagisavvdfi
fnhtsnehewaqrcaagdplfdnfyyifpdrrmpdqydrtlreifpdqhpggfsqledgr
wvwttfnsfqwdlnysnpwvframagemlflanlgvdilrmdavafiwkqmgtscenlpq
ahalirafnavmriaapavffkseaivhpdqvvqyigqdecqigynplqmallwntlatr
evnllhqaltyrhnlpehtawvnyvrshddigwtfadedaaylgisgydhrqflnrffvn
rfdgsfargvpfqynpstgdcrvsgtaaalvglaqddphavdrikllysialstgglpli
ylgdevgtlndddwsqdsnksddsrwahrprynealyaqrndpstaagqiyqdlrhmiav
rqsnprfdgg

SCOPe Domain Coordinates for d1mw3a2:

Click to download the PDB-style file with coordinates for d1mw3a2.
(The format of our PDB-style files is described here.)

Timeline for d1mw3a2: