| Class i: Low resolution protein structures [58117] (25 folds) |
| Fold i.15: Muscle protein complexes [64616] (1 superfamily) |
Superfamily i.15.1: Muscle protein complexes [64617] (1 family) ![]() |
| Family i.15.1.1: Muscle protein complexes [64618] (3 proteins) |
| Protein Averaged rigor crossbridges from tomograms of insect flight muscle [82952] (1 species) |
| Species Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId:9031] [82953] (11 PDB entries) |
| Domain d1mvwh_: 1mvw H: [79530] |
PDB Entry: 1mvw (more details), 70 Å
SCOPe Domain Sequences for d1mvwh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mvwh_ i.15.1.1 (H:) Averaged rigor crossbridges from tomograms of insect flight muscle {Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId: 9031]}
fdeteiedfkeaftvidqnadgiidkddlretfaamgrlnvkneeldamikeasgpinft
vfltmfgeklkgadpedvimgafkvldpdgkgsikksfleellttgggrftpeeiknmwa
afppdvagnvdyknicyvithgeda
Timeline for d1mvwh_:
View in 3DDomains from other chains: (mouse over for more information) d1mvw1_, d1mvw2_, d1mvw3_, d1mvw4_, d1mvw5_, d1mvw6_, d1mvw7_, d1mvw8_, d1mvw9_, d1mvwa_, d1mvwb_, d1mvwc_, d1mvwd_, d1mvwe_, d1mvwf_, d1mvwg_, d1mvwi_, d1mvwj_, d1mvwk_, d1mvwl_, d1mvwm_, d1mvwn_, d1mvwo_, d1mvwp_, d1mvwq_, d1mvwr_, d1mvwv_, d1mvww_, d1mvwx_, d1mvwy_, d1mvwz_ |