Lineage for d1mvwe_ (1mvw E:)

  1. Root: SCOPe 2.05
  2. 1970697Class i: Low resolution protein structures [58117] (25 folds)
  3. 1973147Fold i.15: Muscle protein complexes [64616] (1 superfamily)
  4. 1973148Superfamily i.15.1: Muscle protein complexes [64617] (1 family) (S)
  5. 1973149Family i.15.1.1: Muscle protein complexes [64618] (3 proteins)
  6. 1973154Protein Averaged rigor crossbridges from tomograms of insect flight muscle [82952] (1 species)
  7. 1973155Species Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId:9031] [82953] (11 PDB entries)
  8. 1973276Domain d1mvwe_: 1mvw E: [79527]

Details for d1mvwe_

PDB Entry: 1mvw (more details), 70 Å

PDB Description: molecular models of averaged rigor crossbridges from tomograms of insect flight muscle
PDB Compounds: (E:) skeletal muscle myosin II regulatory; light chain

SCOPe Domain Sequences for d1mvwe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mvwe_ i.15.1.1 (E:) Averaged rigor crossbridges from tomograms of insect flight muscle {Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId: 9031]}
fdeteiedfkeaftvidqnadgiidkddlretfaamgrlnvkneeldamikeasgpinft
vfltmfgeklkgadpedvimgafkvldpdgkgsikksfleellttgggrftpeeiknmwa
afppdvagnvdyknicyvithgeda

SCOPe Domain Coordinates for d1mvwe_:

Click to download the PDB-style file with coordinates for d1mvwe_.
(The format of our PDB-style files is described here.)

Timeline for d1mvwe_: