SCOPe 2.05: Domain d1mvwb_: 1mvw B:

Lineage for d1mvwb_ (1mvw B:)

1. Root: SCOPe 2.05

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.15: Muscle protein complexes [64616] (1 superfamily)

4. Superfamily i.15.1: Muscle protein complexes [64617] (1 family)

5. Family i.15.1.1: Muscle protein complexes [64618] (3 proteins)

6. Protein Averaged rigor crossbridges from tomograms of insect flight muscle [82952] (1 species)

7. Species Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId:9031] [82953] (11 PDB entries)

8. Domain d1mvwb_: 1mvw B: [79524]

Details for d1mvwb_

PDB Entry: 1mvw, 70 Å

PDB Description: molecular models of averaged rigor crossbridges from tomograms of insect flight muscle

PDB Compounds: (B:) skeletal muscle myosin II regulatory; light chain

SCOPe Domain Sequences for d1mvwb_:

Sequence; same for both SEQRES and ATOM records:

>d1mvwb_ i.15.1.1 (B:) Averaged rigor crossbridges from tomograms of insect flight muscle {Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId: 9031]}
fdeteiedfkeaftvidqnadgiidkddlretfaamgrlnvkneeldamikeasgpinft
vfltmfgeklkgadpedvimgafkvldpdgkgsikksfleellttgggrftpeeiknmwa
afppdvagnvdyknicyvithgeda

Timeline for d1mvwb_:

• d1mvwb_ first appeared in SCOP 1.63
  
• d1mvwb_ appears in SCOPe 2.04
  
• d1mvwb_ appears in SCOPe 2.06
  
• d1mvwb_ appears in the current release, SCOPe 2.08