Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) |
Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins) |
Protein Immunoglobulin-binding protein G, different constituent domains [54360] (3 species) |
Species Streptococcus sp., group G [TaxId:1306] [54361] (31 PDB entries) |
Domain d1mvkl_: 1mvk L: [79512] X-ray structure of the intertwined tetramer resulted from a core mutation complexed with so4; mutant |
PDB Entry: 1mvk (more details), 2.5 Å
SCOPe Domain Sequences for d1mvkl_:
Sequence, based on SEQRES records: (download)
>d1mvkl_ d.15.7.1 (L:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]} mqykvilngktlkgettteavdaatfekvvkqffndngvdgewtyddatktftvt
>d1mvkl_ d.15.7.1 (L:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]} mqykvilnteavdaatfekvvkqffndngvdgewtyddatktftvt
Timeline for d1mvkl_: