SCOP 1.75: Domain d1mujb1: 1muj B:94-192

Lineage for d1mujb1 (1muj B:94-192)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (16 PDB entries)
   probably orthologous to the human HLA-DQ group

8. Domain d1mujb1: 1muj B:94-192 [79490]
   Other proteins in same PDB: d1muja1, d1muja2, d1mujb2
   complexed with nag

Details for d1mujb1

PDB Entry: 1muj, 2.15 Å

PDB Description: crystal structure of murine class ii mhc i-ab in complex with a human clip peptide

PDB Compounds: (B:) H-2 class II histocompatibility antigen, A beta chain

SCOP Domain Sequences for d1mujb1:

Sequence, based on SEQRES records:

>d1mujb1 b.1.1.2 (B:94-192) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
leqpnvvislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdw
tfqvlvmlemtprrgevytchvehpslkspitvewssae

Sequence, based on observed residues (ATOM records):

>d1mujb1 b.1.1.2 (B:94-192) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
leqpnvvislshntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdwtfqvlvm
lemtprrgevytchvehpslkspitvewssae

Timeline for d1mujb1:

• d1mujb1 first appeared in SCOP 1.63
  
• d1mujb1 appears in SCOP 1.73
  
• d1mujb1 appears in SCOPe 2.01
  
• d1mujb1 appears in the current release, SCOPe 2.08