SCOP 1.67: Domain d1mq3a1: 1mq3 A:10-91

Lineage for d1mq3a1 (1mq3 A:10-91)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.60: SAM domain-like [47768] (13 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)

6. Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
   topologically similar to the second domain

7. Species Human (Homo sapiens) [TaxId:9606] [47805] (92 PDB entries)

8. Domain d1mq3a1: 1mq3 A:10-91 [79397]
   Other proteins in same PDB: d1mq3a2, d1mq3a3
   complexed with 8og, dcp, doc, mg, na

Details for d1mq3a1

PDB Entry: 1mq3, 2.8 Å

PDB Description: Human DNA Polymerase Beta Complexed With Gapped DNA Containing an 8-oxo-7,8-dihydro-Guanine Template Paired with dCTP

SCOP Domain Sequences for d1mq3a1:

Sequence; same for both SEQRES and ATOM records:

>d1mq3a1 a.60.6.1 (A:10-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens)}
tlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtki
aekideflatgklrklekirqd

Timeline for d1mq3a1:

• d1mq3a1 first appeared in SCOP 1.63
  
• d1mq3a1 appears in SCOP 1.65
  
• d1mq3a1 appears in SCOP 1.69
  
• d1mq3a1 appears in the current release, SCOPe 2.08