Lineage for d1mp4b_ (1mp4 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2505843Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2505844Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2506034Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 proteins)
    automatically mapped to Pfam PF00483
  6. 2506053Protein RmlA (RfbA) [53465] (5 species)
  7. 2506150Species Salmonella enterica [TaxId:28901] [64135] (5 PDB entries)
  8. 2506160Domain d1mp4b_: 1mp4 B: [79377]
    complexed with upg

Details for d1mp4b_

PDB Entry: 1mp4 (more details), 2.2 Å

PDB Description: w224h variant of s. enterica rmla
PDB Compounds: (B:) W224H Variant of S. Enterica RmlA Bound to UDP-Glucose

SCOPe Domain Sequences for d1mp4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mp4b_ c.68.1.6 (B:) RmlA (RfbA) {Salmonella enterica [TaxId: 28901]}
mktrkgiilaggsgtrlypvtmavsqqllpiydkpmiyyplstlmlagirdiliistpqd
tprfqqllgdgsqwglnlqykvqpspdglaqafiigeefighddcalvlgdnifyghdlp
klmeaavnkesgatvfayhvndperygvvefdqagtavsleekplqpksnyavtglyfyd
nsvvemaknlkpsargeleitdinriymeqgrlsvammgrgyahldtgthqslieasnfi
atieerqglkvscpeeiafrknfinaqqvielagplskndygkyllkmv

SCOPe Domain Coordinates for d1mp4b_:

Click to download the PDB-style file with coordinates for d1mp4b_.
(The format of our PDB-style files is described here.)

Timeline for d1mp4b_: