Lineage for d1mmua_ (1mmu A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 945420Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 945547Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 945752Family b.30.5.4: Aldose 1-epimerase (mutarotase) [74911] (2 proteins)
  6. 945757Protein Galactose mutarotase [74912] (3 species)
  7. 945767Species Lactococcus lactis [TaxId:1358] [74913] (19 PDB entries)
  8. 945772Domain d1mmua_: 1mmu A: [79303]
    complexed with bgc, na

Details for d1mmua_

PDB Entry: 1mmu (more details), 1.8 Å

PDB Description: crystal structure of galactose mutarotase from lactococcus lactis complexed with d-glucose
PDB Compounds: (A:) aldose 1-epimerase

SCOPe Domain Sequences for d1mmua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mmua_ b.30.5.4 (A:) Galactose mutarotase {Lactococcus lactis [TaxId: 1358]}
sikirdfglgsdlisltnkagvtisftnlgarivdwqkdgkhlilgfdsakeylekdayp
gatvgptagrikdglvkisgkdyilnqnegpqtlhggeesihtklwtyevtdlgaevqvk
fslvsndgtngypgkiemsvthsfdddnkwkihyeaisdkdtvfnptghvyfnlngdase
svenhglrlaasrfvplkdqteivrgdivdikntdldfrqekqlsnafnsnmeqvqlvkg
idhpflldqlgldkeqarltlddtsisvftdqpsiviftanfgdlgtlyhekkqvhhggi
tfecqvspgseqipelgdislkagekyqattiyslhtkl

SCOPe Domain Coordinates for d1mmua_:

Click to download the PDB-style file with coordinates for d1mmua_.
(The format of our PDB-style files is described here.)

Timeline for d1mmua_: