Lineage for d1ml5o_ (1ml5 O:)

  1. Root: SCOP 1.67
  2. 432183Class i: Low resolution protein structures [58117] (22 folds)
  3. 432184Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 432185Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 432186Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 432187Protein 70S ribosome functional complex [58121] (2 species)
  7. 432188Species Escherichia coli [TaxId:562] [58123] (27 PDB entries)
  8. 432358Domain d1ml5o_: 1ml5 O: [79270]

Details for d1ml5o_

PDB Entry: 1ml5 (more details)

PDB Description: structure of the e. coli ribosomal termination complex with release factor 2

SCOP Domain Sequences for d1ml5o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ml5o_ i.1.1.1 (O:) 70S ribosome functional complex {Escherichia coli}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkea

SCOP Domain Coordinates for d1ml5o_:

Click to download the PDB-style file with coordinates for d1ml5o_.
(The format of our PDB-style files is described here.)

Timeline for d1ml5o_: